Anti-EXPH5 antibody
| Name | Anti-EXPH5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99021 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Rat, Horse, Bovine |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 1907-1956 (QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEP L) of Human EXPH5 (NP_055880) |
| Description | Rabbit Polyclonal |
| Gene | EXPH5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-EXPH5 antibody (ab99021) at 1 µg/ml + ACHN cell lysate at 10 µg
Product References
Mutations in EXPH5 result in autosomal recessive inherited skin fragility. - Mutations in EXPH5 result in autosomal recessive inherited skin fragility.
Liu L, Mellerio JE, Martinez AE, McMillan JR, Aristodemou S, Parsons M, McGrath JA. Br J Dermatol. 2014 Jan;170(1):196-9.
Germline Mutation in EXPH5 Implicates the Rab27B Effector Protein Slac2-b in - Germline Mutation in EXPH5 Implicates the Rab27B Effector Protein Slac2-b in
McGrath JA, Stone KL, Begum R, Simpson MA, Dopping-Hepenstal PJ, Liu L, McMillan JR, South AP, Pourreyron C, McLean WH, Martinez AE, Mellerio JE, Parsons M. Am J Hum Genet. 2012 Dec 7;91(6):1115-21.