ABCF2 antibody

Name ABCF2 antibody
Supplier Fitzgerald
Catalog 70R-5704
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL
Purity/Format Affinity purified
Blocking Peptide ABCF2 Blocking Peptide
Description Rabbit polyclonal ABCF2 antibody
Gene ABCF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.