Name | DGCR8 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4730 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR |
Purity/Format | Affinity purified |
Blocking Peptide | DGCR8 Blocking Peptide |
Description | Rabbit polyclonal DGCR8 antibody raised against the N terminal of DGCR8 |
Gene | DGCR8 |
Supplier Page | Shop |