| Name | ADCY6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5955 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | ADCY6 Blocking Peptide |
| Description | Rabbit polyclonal ADCY6 antibody raised against the C terminal of ADCY6 |
| Gene | ADCY6 |
| Supplier Page | Shop |