| Name | MYD88 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5825 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP |
| Purity/Format | Affinity purified |
| Blocking Peptide | MYD88 Blocking Peptide |
| Description | Rabbit polyclonal MYD88 antibody |
| Gene | MYD88 |
| Supplier Page | Shop |