| Name | EXPH5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3864 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | EXPH5 Blocking Peptide |
| Description | Rabbit polyclonal EXPH5 antibody raised against the middle region of EXPH5 |
| Gene | EXPH5 |
| Supplier Page | Shop |