| Name | GOPC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3008 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GOPC antibody was raised using the middle region of GOPC corresponding to a region with amino acids RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | GOPC Blocking Peptide |
| Description | Rabbit polyclonal GOPC antibody raised against the middle region of GOPC |
| Gene | GOPC |
| Supplier Page | Shop |