| Name | RAB38 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5865 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB38 Blocking Peptide |
| Description | Rabbit polyclonal RAB38 antibody raised against the N terminal of RAB38 |
| Gene | RAB38 |
| Supplier Page | Shop |