| Name | PHACS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1018 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PHACS antibody was raised using a synthetic peptide corresponding to a region with amino acids RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PHACS Blocking Peptide |
| Description | Rabbit polyclonal PHACS antibody |
| Gene | ACSS2 |
| Supplier Page | Shop |