Name | TPTE antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1628 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | TPTE Blocking Peptide |
Description | Rabbit polyclonal TPTE antibody raised against the C terminal of TPTE |
Gene | TPTE |
Supplier Page | Shop |