FUNDC1 antibody

Name FUNDC1 antibody
Supplier Fitzgerald
Catalog 70R-3364
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FUNDC1 antibody was raised using the middle region of FUNDC1 corresponding to a region with amino acids TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN
Purity/Format Affinity purified
Blocking Peptide FUNDC1 Blocking Peptide
Description Rabbit polyclonal FUNDC1 antibody raised against the middle region of FUNDC1
Gene FUNDC1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.