CHTF18 antibody

Name CHTF18 antibody
Supplier Fitzgerald
Catalog 70R-3759
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLVGTMLAYSLTYRQERTPDGQYIYRLEPNVEELCRFPELPARKPLTYQT
Purity/Format Affinity purified
Blocking Peptide CHTF18 Blocking Peptide
Description Rabbit polyclonal CHTF18 antibody
Gene CHTF18
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.