| Name | RPS3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2444 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPS3A antibody was raised using the N terminal of RPS3A corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPS3A Blocking Peptide |
| Description | Rabbit polyclonal RPS3A antibody raised against the N terminal of RPS3A |
| Gene | RPS3A |
| Supplier Page | Shop |