| Name | LIN7C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2578 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | LIN7C Blocking Peptide |
| Description | Rabbit polyclonal LIN7C antibody |
| Gene | LIN7C |
| Supplier Page | Shop |