Name | CIRBP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5012 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG |
Purity/Format | Affinity purified |
Blocking Peptide | CIRBP Blocking Peptide |
Description | Rabbit polyclonal CIRBP antibody raised against the N terminal of CIRBP |
Gene | CIRBP |
Supplier Page | Shop |