| Name | CIRBP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5012 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CIRBP Blocking Peptide |
| Description | Rabbit polyclonal CIRBP antibody raised against the N terminal of CIRBP |
| Gene | CIRBP |
| Supplier Page | Shop |