| Name | PIK3R4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5627 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIK3R4 Blocking Peptide |
| Description | Rabbit polyclonal PIK3R4 antibody raised against the N terminal of PIK3R4 |
| Gene | IKBKAP |
| Supplier Page | Shop |