| Name | B3GALT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7177 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI |
| Purity/Format | Affinity purified |
| Blocking Peptide | B3GALT1 Blocking Peptide |
| Description | Rabbit polyclonal B3GALT1 antibody raised against the C terminal of B3GALT1 |
| Gene | B3GALT1 |
| Supplier Page | Shop |