| Name | IFIT5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5819 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IFIT5 antibody was raised using the N terminal of IFIT5 corresponding to a region with amino acids LEEAQKYTGKIGNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | IFIT5 Blocking Peptide |
| Description | Rabbit polyclonal IFIT5 antibody raised against the N terminal of IFIT5 |
| Gene | IFIT5 |
| Supplier Page | Shop |