| Name | TRIM54 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2647 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids IYKQESSRPLHSKAEQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHK |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIM54 Blocking Peptide |
| Description | Rabbit polyclonal TRIM54 antibody raised against the N terminal of TRIM54 |
| Gene | TRIM54 |
| Supplier Page | Shop |