| Name | DDAH2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5792 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS |
| Purity/Format | Affinity purified |
| Blocking Peptide | DDAH2 Blocking Peptide |
| Description | Rabbit polyclonal DDAH2 antibody raised against the N terminal of DDAH2 |
| Gene | DDAH2 |
| Supplier Page | Shop |