| Name | IFI35 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1979 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | IFI35 Blocking Peptide |
| Description | Rabbit polyclonal IFI35 antibody raised against the N terminal of IFI35 |
| Gene | IFI35 |
| Supplier Page | Shop |