ABCB4 antibody

Name ABCB4 antibody
Supplier Fitzgerald
Catalog 70R-6710
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
Purity/Format Affinity purified
Blocking Peptide ABCB4 Blocking Peptide
Description Rabbit polyclonal ABCB4 antibody
Gene ABCB4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.