| Name | UGP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4104 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | UGP2 antibody was raised using the N terminal of UGP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN |
| Purity/Format | Affinity purified |
| Blocking Peptide | UGP2 Blocking Peptide |
| Description | Rabbit polyclonal UGP2 antibody raised against the N terminal of UGP2 |
| Gene | UGP2 |
| Supplier Page | Shop |