MTHFD2L antibody

Name MTHFD2L antibody
Supplier Fitzgerald
Catalog 70R-3409
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MTHFD2L antibody was raised using a synthetic peptide corresponding to a region with amino acids TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP
Purity/Format Affinity purified
Blocking Peptide MTHFD2L Blocking Peptide
Description Rabbit polyclonal MTHFD2L antibody
Gene MTHFD2L
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.