| Name | KCNN2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5106 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNN2 Blocking Peptide |
| Description | Rabbit polyclonal KCNN2 antibody raised against the middle region of KCNN2 |
| Gene | PAPSS2 |
| Supplier Page | Shop |