PAFAH1B1 antibody

Name PAFAH1B1 antibody
Supplier Fitzgerald
Catalog 70R-5657
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PAFAH1B1 antibody was raised using the N terminal of PAFAH1B1 corresponding to a region with amino acids KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF
Purity/Format Affinity purified
Blocking Peptide PAFAH1B1 Blocking Peptide
Description Rabbit polyclonal PAFAH1B1 antibody raised against the N terminal of PAFAH1B1
Gene PAFAH1B1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.