| Name | BAG3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6022 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS |
| Purity/Format | Affinity purified |
| Blocking Peptide | BAG3 Blocking Peptide |
| Description | Rabbit polyclonal BAG3 antibody raised against the middle region of BAG3 |
| Gene | BAG3 |
| Supplier Page | Shop |