KCNRG antibody

Name KCNRG antibody
Supplier Fitzgerald
Catalog 70R-5094
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF
Purity/Format Affinity purified
Blocking Peptide KCNRG Blocking Peptide
Description Rabbit polyclonal KCNRG antibody raised against the N terminal of KCNRG
Gene KCNRG
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.