| Name | LMAN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1877 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | LMAN1 Blocking Peptide |
| Description | Rabbit polyclonal LMAN1 antibody raised against the middle region of LMAN1 |
| Gene | LMAN1 |
| Supplier Page | Shop |