HNF4G antibody

Name HNF4G antibody
Supplier Fitzgerald
Catalog 70R-1917
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HNF4G antibody was raised using the N terminal of HNF4G corresponding to a region with amino acids MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA
Purity/Format Affinity purified
Blocking Peptide HNF4G Blocking Peptide
Description Rabbit polyclonal HNF4G antibody raised against the N terminal of HNF4G
Gene HNF4A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.