| Name | ACADSB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2531 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACADSB Blocking Peptide |
| Description | Rabbit polyclonal ACADSB antibody raised against the middle region of ACADSB |
| Gene | ACADSB |
| Supplier Page | Shop |