| Name | RAB5B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5873 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAB5B Blocking Peptide |
| Description | Rabbit polyclonal RAB5B antibody raised against the N terminal of RAB5B |
| Gene | RAB5B |
| Supplier Page | Shop |