| Name | BAAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2871 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR |
| Purity/Format | Affinity purified |
| Blocking Peptide | BAAT Blocking Peptide |
| Description | Rabbit polyclonal BAAT antibody raised against the N terminal of BAAT |
| Gene | BAAT |
| Supplier Page | Shop |