| Name | MLSTD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1829 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MLSTD2 Blocking Peptide |
| Description | Rabbit polyclonal MLSTD2 antibody raised against the N terminal Of Mlstd2 |
| Gene | FAR1 |
| Supplier Page | Shop |