MLSTD2 antibody

Name MLSTD2 antibody
Supplier Fitzgerald
Catalog 70R-1829
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Purity/Format Total IgG Protein A purified
Blocking Peptide MLSTD2 Blocking Peptide
Description Rabbit polyclonal MLSTD2 antibody raised against the N terminal Of Mlstd2
Gene FAR1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.