Anti-Heme Oxygenase 1 antibody [HO-1-1]
| Name | Anti-Heme Oxygenase 1 antibody [HO-1-1] |
|---|---|
| Supplier | Abcam |
| Catalog | ab13248 |
| Prices | $403.00 |
| Sizes | 200 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | HO-1-1 |
| Applications | WB ICC/IF FC ELISA IP ELISA IHC-P ICC/IF ICC/IF IHC-F |
| Species Reactivities | Mouse, Rat, Bovine, Dog, Human, Monkey, Pig |
| Antigen | Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN , corresponding to amino acids 1-30 of Human Heme Oxygenase 1 |
| Description | Mouse Monoclonal |
| Gene | HMOX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Standard Curve for Heme Oxygenase 1 (Analyte: Heme Oxygenase 1 protein (Tagged) (ab85243)); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse monoclonal [HO-1-1] to Heme Oxygenase 1 (ab13248) at 5µg/ml and Detector Antibody Rabbit polyclonal to Heme Oxygenase 1 (ab13243) at 0.5µg/ml.](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_2/29825_Heme-Oxygenase-1-Primary-antibodies-ab13248-10.jpg)
Standard Curve for Heme Oxygenase 1 (Analyte: Heme Oxygenase 1 protein (Tagged) (ab85243)); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse monoclonal [HO-1-1] to Heme Oxygenase 1 (ab13248) at 5µg/ml and Detector Antibody Rabbit polyclonal to Heme Oxygenase 1 (ab13243) at 0.5µg/ml.
![Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1/250 dilution + Human microsome lysate](http://www.bioprodhub.com/system/product_images/ab_products/2/sub_2/29827_Heme-Oxygenase-1-Primary-antibodies-ab13248-4.jpg)
Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1/250 dilution + Human microsome lysate
ab13248 at 10µg/ml staining Heme Oxygenase 1 in human lung cancer A2 cells by flow cytometery. The left image repersents staining with isotype control antibody and the right image show staining with ab13248.
ab13248 staining Heme Oxygenase 1 in murine heart tissue by Immunohistochemistry (Frozen sections).Tissue was fixed in paraformaldehyde, permeabilized, blocked using 2% serum for 1 hour at 30°C and then incubated with ab13248 at a 1/300 dilution for 12 hours at 4°C. The secondary used was an Alexa-Fluor 488 conjugated goat polyclonal used at a 1/500 dilution.The green colour indicate Heme Oxygenase 1.The blue colour indicate nucleus stain DAPI.See Abreview
Product References
HO-1 up-regulation: a key point in high-risk neuroblastoma resistance to - HO-1 up-regulation: a key point in high-risk neuroblastoma resistance to
Furfaro AL, Piras S, Passalacqua M, Domenicotti C, Parodi A, Fenoglio D, Pronzato MA, Marinari UM, Moretta L, Traverso N, Nitti M. Biochim Biophys Acta. 2014 Apr;1842(4):613-22.
Cancer-derived mutations in KEAP1 impair NRF2 degradation but not ubiquitination. - Cancer-derived mutations in KEAP1 impair NRF2 degradation but not ubiquitination.
Hast BE, Cloer EW, Goldfarb D, Li H, Siesser PF, Yan F, Walter V, Zheng N, Hayes DN, Major MB. Cancer Res. 2014 Feb 1;74(3):808-17.
A network pharmacology study of Chinese medicine QiShenYiQi to reveal its - A network pharmacology study of Chinese medicine QiShenYiQi to reveal its
Li X, Wu L, Liu W, Jin Y, Chen Q, Wang L, Fan X, Li Z, Cheng Y. PLoS One. 2014 May 9;9(5):e95004.
Nrf2 upregulates ATP binding cassette transporter expression and activity at the - Nrf2 upregulates ATP binding cassette transporter expression and activity at the
Wang X, Campos CR, Peart JC, Smith LK, Boni JL, Cannon RE, Miller DS. J Neurosci. 2014 Jun 18;34(25):8585-93.
Cleavage by signal peptide peptidase is required for the degradation of selected - Cleavage by signal peptide peptidase is required for the degradation of selected
Boname JM, Bloor S, Wandel MP, Nathan JA, Antrobus R, Dingwell KS, Thurston TL, Smith DL, Smith JC, Randow F, Lehner PJ. J Cell Biol. 2014 Jun 23;205(6):847-62.
Induction of heme oxygenase I (HMOX1) by HPP-4382: a novel modulator of Bach1 - Induction of heme oxygenase I (HMOX1) by HPP-4382: a novel modulator of Bach1
Attucks OC, Jasmer KJ, Hannink M, Kassis J, Zhong Z, Gupta S, Victory SF, Guzel M, Polisetti DR, Andrews R, Mjalli AM, Kostura MJ. PLoS One. 2014 Jul 14;9(7):e101044.
Differential effects of 670 and 830 nm red near infrared irradiation therapy: a - Differential effects of 670 and 830 nm red near infrared irradiation therapy: a
Giacci MK, Wheeler L, Lovett S, Dishington E, Majda B, Bartlett CA, Thornton E, Harford-Wright E, Leonard A, Vink R, Harvey AR, Provis J, Dunlop SA, Hart NS, Hodgetts S, Natoli R, Van Den Heuvel C, Fitzgerald M. PLoS One. 2014 Aug 8;9(8):e104565.
Nrf2 is not required for epithelial prohibitin-dependent attenuation of - Nrf2 is not required for epithelial prohibitin-dependent attenuation of
Kathiria AS, Butcher MA, Hansen JM, Theiss AL. Am J Physiol Gastrointest Liver Physiol. 2013 May 15;304(10):G885-96. doi:
Hydrogen gas reduces hyperoxic lung injury via the Nrf2 pathway in vivo. - Hydrogen gas reduces hyperoxic lung injury via the Nrf2 pathway in vivo.
Kawamura T, Wakabayashi N, Shigemura N, Huang CS, Masutani K, Tanaka Y, Noda K, Peng X, Takahashi T, Billiar TR, Okumura M, Toyoda Y, Kensler TW, Nakao A. Am J Physiol Lung Cell Mol Physiol. 2013 May 15;304(10):L646-56. doi:
Reactivity of chemical sensitizers toward amino acids in cellulo plays a role in - Reactivity of chemical sensitizers toward amino acids in cellulo plays a role in
Migdal C, Botton J, El Ali Z, Azoury ME, Guldemann J, Gimenez-Arnau E, Lepoittevin JP, Kerdine-Romer S, Pallardy M. Toxicol Sci. 2013 Jun;133(2):259-74.