Name | Anti-IQCK antibody |
---|---|
Supplier | Abcam |
Catalog | ab89797 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 144-193 ( MASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIP ) of Human IQCK (NP_694940) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | IQCK |
Conjugate | Unconjugated |
Supplier Page | Shop |