Anti-IQCK antibody
| Name | Anti-IQCK antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab89797 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 144-193 ( MASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIP ) of Human IQCK (NP_694940) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | IQCK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IQCK antibody (ab89797) at 1 µg/ml + SH-SYSY cell lysate at 10 µgSecondaryHRP anti rabbit IgG at 1/50000 dilution