Anti-IZUMO4 antibody
| Name | Anti-IZUMO4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125378 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 183-232 ( SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQH ) of Human IZUMO4; isoform 1 (NP_001034935) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | IZUMO4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-IZUMO4 antibody (ab125378) at 1 µg/ml + HepG2 cell lysate at 10 µg with milk at 5 %