Anti-Junctional Adhesion Molecule C antibody
| Name | Anti-Junctional Adhesion Molecule C antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81331 |
| Prices | $380.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to N terminal amino acids 72-122 IGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYV of Human Junctional Adhesion Molecule C (EAW67820) |
| Description | Rabbit Polyclonal |
| Gene | JAM3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Junctional Adhesion Molecule C antibody (ab81331) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
All lanes : Anti-Junctional Adhesion Molecule C antibody (ab81331) at 1/1000 dilutionLane 1 : JAM3-transfected HEK293 purified protein at 15 µgLane 2 : JAM3-transfected HEK293 purified protein at 10 µgLane 3 : JAM3-transfected HEK293 purified protein at 5 µgSecondaryAn HRP-conjugated goat anti-rabbit IgG at 1/5000 dilutiondeveloped using the ECL technique