Natriuretic peptides B antibody

Name Natriuretic peptides B antibody
Supplier Acris Antibodies
Catalog PAB5082
Prices $420.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications ELISA RIA
Species Reactivities Rat
Antigen A synthetic peptide (conjugated with KLH) corresponding to amino acids (NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF) of rat Nppb.
Description Rabbit Polyclonal
Gene Nppb
Conjugate KLH
Supplier Page Shop