Anti-MTCO3 antibody
| Name | Anti-MTCO3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81180 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Chimpanzee |
| Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 181-230 (FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSK H) of Human Cytochrome C Oxidase subunit III, NP_536849 |
| Description | Rabbit Polyclonal |
| Gene | COX3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-MTCO3 antibody (ab81180) at 1 µg/ml + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution