Name | Anti-MTCO3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab81180 |
Prices | $376.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Chimpanzee |
Antigen | Synthetic peptide, corresponding to a region within C terminal amino acids 181-230 (FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSK H) of Human Cytochrome C Oxidase subunit III, NP_536849 |
Description | Rabbit Polyclonal |
Gene | COX3 |
Conjugate | Unconjugated |
Supplier Page | Shop |