Name | Anti-PRKX antibody |
---|---|
Supplier | Abcam |
Catalog | ab98196 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50, MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD , of Human PRKX (NP_005035) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | PRKX |
Conjugate | Unconjugated |
Supplier Page | Shop |