Anti-PRKX antibody
| Name | Anti-PRKX antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98196 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50, MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD , of Human PRKX (NP_005035) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | PRKX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-PRKX antibody (ab98196) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution