Anti-Protein phosphatase 1 inhibitor subunit 2 antibody
| Name | Anti-Protein phosphatase 1 inhibitor subunit 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116047 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 27-76 ( ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH ) of Human Protein phosphatase 1 inhibitor subunit 2 (NP_006232) |
| Description | Rabbit Polyclonal |
| Gene | PPP1R2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Protein phosphatase 1 inhibitor subunit 2 antibody (ab116047) at 1 µg/ml + THP-1 cell lysate at 10 µg