Anti-RBP2 antibody
| Name | Anti-RBP2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102840 |
| Prices | $370.00 |
| Sizes | 400 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence amino acids 63-92, VDFTVGVEFDEYTKSLDNRHVKALVTWEGD , of Human RBP2 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | RBP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-RBP2 antibody (ab102840) at 2 µg/ml + 293 cell lysate at 35 µg