Anti-STAT5b antibody
| Name | Anti-STAT5b antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86586 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | A synthetic peptide corresponding to a region within N terminal amino acids 2-51( AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP ) of Human STAT5b (NP_036580) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | STAT5B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling STAT5b with ab86586 ay 5µg/ml.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human prostate tissue labelling STAT5b with ab86586 ay 5µg/ml.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling STAT5b with ab86586 ay 5µg/ml.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling STAT5b with ab86586 ay 5µg/ml.
Anti-STAT5b antibody (ab86586) at 1 µg/ml + transfected 293T cell lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution