Name | Anti-STAT5b antibody |
---|---|
Supplier | Abcam |
Catalog | ab86586 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
Antigen | A synthetic peptide corresponding to a region within N terminal amino acids 2-51( AVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNP ) of Human STAT5b (NP_036580) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | STAT5B |
Conjugate | Unconjugated |
Supplier Page | Shop |