Numb Antibody

• Supplier: Genway Biotech
• Catalog: GWB-MV602H
• Prices: $368.00
• Sizes: 50 µg
• Host: Rabbit
• Applications: WB IHC
• Species Reactivities: Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
• Antigen: Synthetic Peptide within the following region: ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF
• Purity/Format: Lyophilized powder. Add 50 ul of distilled water. Final anti-Numb antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose.
• Description: Rabbit
• Gene: Numb