Anti-VMAT1 antibody
| Name | Anti-VMAT1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86325 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 476-525 (YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHE E) of Human VMAT1, NP_003044 |
| Description | Rabbit Polyclonal |
| Gene | SLC18A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325.
Anti-VMAT1 antibody (ab86325) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA fixed paraffin-embedded sections) analysis of human brain cortex tissue labeling VMAT1 with ab86325 at 2.5ug/ml. HRP/DAB detection.