Anti-ZNF8 antibody
| Name | Anti-ZNF8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab90734 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse, Bovine, Cat, Dog |
| Antigen | A synthetic peptide corresponding to a region within N terminal amino acids 36 - 85 ( QEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELWV ) of Human ZNF8 (NP_066575) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ZNF8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ZNF8 antibody (ab90734) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution