Rabbit anti-Mouse APH1a polyclonal antibody

• Supplier: Creative Diagnostics
• Catalog: DPABH-27841
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC-F WB IHC-P
• Species Reactivities: Mouse, Rat, Human
• Antigen: Synthetic peptide within Mouse APH1a aa 90-140 (internal sequence). The exact sequence is proprietary. Conjugated to an immunogenic carrier protein.Sequence: YYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILA D Database link: Q8BVF7
• Purity/Format: Whole antiserum
• Description: Rabbit Polyclonal
• Gene: Aph1a
• Conjugate: Unconjugated