Name | Anti-IZUMO4 (aa 183-232) polyclonal antibody |
---|---|
Supplier | Creative Diagnostics |
Catalog | DPABH-22251 |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 183-232 (SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQ H) of Human IZUMO4; isoform 1 (NP_001034935) |
Description | Rabbit Polyclonal |
Gene | IZUMO4 |
Conjugate | Unconjugated |
Supplier Page | Shop |