Anti-IZUMO4 (aa 183-232) polyclonal antibody

Name Anti-IZUMO4 (aa 183-232) polyclonal antibody
Supplier Creative Diagnostics
Catalog DPABH-22251
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide corresponding to a region within C terminal amino acids 183-232 (SMRPRSSAFSWPGTHRATPAFLVSPALRCLEPPHLANLTLEDAAECLKQ H) of Human IZUMO4; isoform 1 (NP_001034935)
Description Rabbit Polyclonal
Gene IZUMO4
Conjugate Unconjugated
Supplier Page Shop